SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000266744 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000266744
Domain Number 1 Region: 122-196
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.14e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000266744   Gene: ENSG00000139352   Transcript: ENST00000266744
Sequence length 236
Comment pep:known chromosome:GRCh37:12:103351464:103354294:1 gene:ENSG00000139352 transcript:ENST00000266744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQ
QQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAV
ARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAV
SAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
Download sequence
Identical sequences P50553
HR4461 ENSP00000266744 gi|55743094|ref|NP_004307.2| ENSP00000266744 9606.ENSP00000266744 NP_004307.2.87134 NP_004307.2.92137 ENSP00000266744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]