SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Homo sapiens 69_37 > ENSP00000267119

Domain assignment for ENSP00000267119 from Homo sapiens 69_37

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSP00000267119
Domain Number 1	Region: 361-437
Classification Level	Classification	E-value
Superfamily	Intermediate filament protein, coiled coil region	1.67e-21
Family	Intermediate filament protein, coiled coil region	0.00063
Further Details:

Domain Number 2	Region: 129-163
Classification Level	Classification	E-value
Superfamily	Intermediate filament protein, coiled coil region	0.0000000000277
Family	Intermediate filament protein, coiled coil region	0.0016
Further Details:

Domain Number 3	Region: 170-239
Classification Level	Classification	E-value
Superfamily	Intermediate filament protein, coiled coil region	0.0000000251
Family	Intermediate filament protein, coiled coil region	0.0073
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSP00000267119 Gene: ENSG00000139648 Transcript: ENST00000267119
Sequence length	523
Comment	pep:known chromosome:GRCh37:12:52937693:52946931:-1 gene:ENSG00000139648 transcript:ENST00000267119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MSRQFTCKSGAAAKGGFSGCSAVLSGGSSSSFRAGSKGLSGGFGSRSLYSLGGVRSLNVA SGSGKSGGYGFGRGRASGFAGSMFGSVALGPVCPTVCPPGGIHQVTVNESLLAPLNVELD PEIQKVRAQEREQIKALNNKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKNNLEPI LEGYISNLRKQLETLSGDRVRLDSELRNVRDVVEDYKKRYEEEINKRTAAENEFVLLKKD VDAAYANKVELQAKVESMDQEIKFFRCLFEAEITQIQSHISDMSVILSMDNNRNLDLDSI IDEVRTQYEEIALKSKAEAEALYQTKFQELQLAAGRHGDDLKNTKNEISELTRLIQRIRS EIENVKKQASNLETAIADAEQRGDNALKDARAKLDELEGALHQAKEELARMLREYQELMS LKLALDMEIATYRKLLESEECRMSGEFPSPVSISIISSTSGGSVYGFRPSMVSGGYVANS SNCISGVCSVRGGEGRSRGSANDYKDTLGKGSSLSAPSKKTSR
Download sequence
Identical sequences	Q3SY84 ENSP00000267119 9606.ENSP00000267119 ENSP00000267119 ENSP00000267119 NP_258259.1.87134 NP_258259.1.92137 gi\|15618995\|ref\|NP_258259.1\|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]