SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000267525 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000267525
Domain Number 1 Region: 262-498
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-63
Family Nuclear receptor ligand-binding domain 0.000000000566
Further Details:      
 
Domain Number 2 Region: 147-225
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.4e-26
Family Nuclear receptor 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000267525   Gene: ENSG00000140009   Transcript: ENST00000267525
Sequence length 530
Comment pep:known chromosome:GRCh37:14:64699855:64761128:-1 gene:ENSG00000140009 transcript:ENST00000267525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH
NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL
VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK
CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ
Download sequence
Identical sequences Q7LCB3 Q92731
9606.ENSP00000343925 HR4685 IGBMC-0006-000 NP_001428.1.87134 NP_001428.1.92137 XP_016876568.1.92137 XP_016876569.1.92137 XP_016876570.1.92137 XP_016876571.1.92137 XP_016876572.1.92137 gi|10835013|ref|NP_001428.1| ENSP00000343925 ENSP00000267525 ENSP00000343925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]