SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000270001 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000270001
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.59e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 432-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 321-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 474-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-20
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 8 Region: 166-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000270001   Gene: ENSG00000142065   Transcript: ENST00000270001
Sequence length 533
Comment pep:known chromosome:GRCh37:19:36827162:36870101:-1 gene:ENSG00000142065 transcript:ENST00000270001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHGSVTFRDVAIDFSQEEWEFLDPAQRDLYRDVMWENYSNFISLGPSISKPDVITLLDE
ERKEPGMVVREGTRRYCPDLESRYRTNTLSPEKDIYEIYSFQWDIMERIKSYSLQGSIFR
NDWECKSKIEGEKEQQEGYFGQVKITSEKMTTYKRHNFLTEYQIVHNGEKVYECKECRKT
FIRRSTLSQHLRIHTGEKPYKCKECGQAFRQRAHLIRHHKLHTGEKPYECKECGKAFTVL
QELTQHQRLHTGEKPYECKECGKAFRVHQQLARHQRIHTGEKPYECKDCGKTFRQCTHLT
RHQRLHTAEKLYECKECGKAFVCGPDLRVHQKIHFGEKPYECKECGKAFRICQQLTVHQS
IHTGEKPYECKECGKTFRLRQQLVRHQRIHTREKPYECMECWKTFSSYSQLISHQSIHIG
ERPYECEECGKAFRLLSQLTQHQSIHTGEKPYECKECRKPFRLLSQLTQHQSIHTGEKPY
ECKECGKAFRLYSFLTQHQRIHTGEKPYKCKECKKAFRQHSHLTQHQKIHNGI
Download sequence
Identical sequences Q9HCL3
gi|55741659|ref|NP_065968.1| ENSP00000270001 ENSP00000270001 NP_065968.1.87134 NP_065968.1.92137 XP_016882527.1.92137 ENSP00000270001 9606.ENSP00000270001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]