SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000272418 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000272418
Domain Number 1 Region: 175-376
Classification Level Classification E-value
Superfamily PDB 7.17e-74
Family PDB 0.00034
Further Details:      
 
Domain Number 2 Region: 288-367
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.86e-20
Family Translational machinery components 0.0038
Further Details:      
 
Domain Number 3 Region: 214-285
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000000000305
Family Ribosomal S5 protein, N-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000272418   Gene: ENSG00000144029   Transcript: ENST00000272418
Sequence length 430
Comment pep:known chromosome:GRCh37:2:95752952:95787745:-1 gene:ENSG00000144029 transcript:ENST00000272418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAVRAVGCLPVLCSGTAGHLLGRQCSLNTLPAASILAWKSVLGNGHLSSLGTRDTHPY
ASLSRALQTQCCISSPSHLMSQQYRPYSFFTKLTADELWKGALAETGAGAKKGRGKRTKK
KKRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWD
RKKKMKVKRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGRKKS
IRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYEDHTIFHDISLRFKR
THIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVSGSINMLSLTQGLFRGLSRQETHQ
QLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRS
VWSNLKRAAT
Download sequence
Identical sequences P82675
9606.ENSP00000272418 ENSP00000272418 3j9m_AD NP_114108.1.87134 NP_114108.1.92137 ENSP00000272418 ENSP00000272418 gi|13994259|ref|NP_114108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]