SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000274071 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000274071
Domain Number 1 Region: 53-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-21
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 2 Region: 236-338
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.56e-20
Family Platelet-derived growth factor-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000274071   Gene: ENSG00000145431   Transcript: ENST00000274071
Sequence length 345
Comment pep:known chromosome:GRCh37:4:157682766:157892467:-1 gene:ENSG00000145431 transcript:ENST00000274071 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSA
LPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Download sequence
Identical sequences G3QZW6 Q9NRA1
ENSP00000422464 gi|9994187|ref|NP_057289.1| ENSGGOP00000008436 ENSP00000422464 ENSGGOP00000008436 NP_057289.1.87134 NP_057289.1.92137 XP_004040602.1.27298 9606.ENSP00000274071 ENSP00000274071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]