SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000275358 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000275358
Domain Number 1 Region: 1182-1228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000155
Family EGF-type module 0.015
Further Details:      
 
Domain Number 2 Region: 1361-1394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000328
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSP00000275358
Domain Number - Region: 1490-1521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000984
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 1522-1554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000984
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 1426-1456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0019
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 1554-1585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00437
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 1458-1484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00802
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 1394-1425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0113
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000275358   Gene: ENSG00000146530   Transcript: ENST00000275358
Sequence length 1590
Comment pep:novel chromosome:GRCh37:7:12370511:12443531:-1 gene:ENSG00000146530 transcript:ENST00000275358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGACVLVIALMFLAWGEAQECSPGGHQFLRSPYRSVRFDSWHLQQSAVQDLICDHSLS
PGWYRFLILDRPAEMPTKCVEMNHCGTQAPIWLSLRDSETLPSPGEIKQLTACATWQFLF
STTKDCCLFQIPVSVRNCGNFSVYLLQPTQGCMGYCAEAISDARLHPCGSDETETGGDCV
RQLAASLPPPPAGRPEVLVELIESRLFCRCSFDVPATKNSVGFHIAWSRLSSQEVKEELT
QETTVQAFSLLELDGINLRLGDRIFCSASVFFLENPHVQSVAIESQEFFAGFKLQPELST
ISEDGKEYYLRIESTVPIICSEFSELDQECKISLKLKTIGQGREHLGLNLALSSCHVDLL
QTSSCANGTCSHTFVYYTAVTDFSRDGDRVSNIVVQPIVNEDFLWNNYIPDSIQIKVKDV
PTAYCYTFTDPHIITFDGRVYDNFKTGTFVLYKSMSRDFEVHVRQWDCRSLHYPVSCNCG
FVAQEGGDIVTFDMCNGQLRESQPYLFIKSQDVTRNIKISESYLGRKVTIWFSSGAFIRA
DLGEWGMSLTIRAPSVDYRNTLGLCGTFDENPENDFHDKNGMQIDQNFNNYVAFINEWRI
LPGKSMSDTLPVSMTSPGKPSYCSCSLDTAAYPSSEDLDSVSRSEIALGCKDLNHVSLSS
LIPELDVTSEYINSDTLVREINKHTSPEEYNLNLFLQEKKHINLTKLGLNVQKHPGNEKE
DSLQYLANKKYTQGRGSHSQEMRYNRQNRWKRQNFHEFPPLFAFPSLSQTDLEELTYFFP
EDHAEDVQQEFFPSWPTPSGLTEYSTLTLCQETLANSSIGRLCLAFLGKRLDSVIEMCVK
DVLLKDDLSWAEAGVALLENECEKRIVEEGKYNTEEYGTSIEDILSVLKCPNLCSGNGQC
MEWGCACSPSFSSYDCSDSYDKAPEITELGNAGFCDVQKYNCMMVRVFGKGFKELPSIKC
EVTKLQYNSSEWMPGEPIYTQTVFHNSRAVDCQLPTDVQQFDTMDLVGGKPTGKWQLKVS
NDGYKFSNPKITVIYDGACQVCGLYKNDSCTIKENVCIIDGLCYVEGDKNPTSPCLICRP
KISRFTWSFLENNQPPVIQALQDKLQTFYGENFEYQFVAFDPEGSDIHFTLDSGPEGASV
SSAGLFMWKTDLLTTQQITVRLNDDCDAETRVTIEVTVKSCDCLNGGSCVSDRNFSPGSG
VYLCVCLPGFHGSLCEVDISGCQSNPCGLGSYISGFHSYSCDCPPELKVETQFVNQFTTQ
TVVLTRSDKSVNKEEDDKNAQGRKRHVKPTSGNAFTICKYPCGKSRECVAPNICKCKPGY
IGSNCQTALCDPDCKNHGKCIKPNICQCLPGHGGATCDEEHCNPPCQHGGTCLAGNLCTC
PYGFVGPRCETMVCNRHCENGGQCLTPDICQCKPGWYGPTCSTALCDPVCLNGGSCNKPN
TCLCPNGFFGEHCQNAFCHPPCKNGGHCMRNNVCVCREGYTGRRFQKSICDPTCMNGGKC
VGPSTCSCPSGWSGKRCNTPICLQKCKNGGECIAPSICHCPSSWEGVRCQIPICNPKCLY
GGRCIFPNVCSCRTEYSGVKCEKKIQIRRH
Download sequence
Identical sequences Q8N2E2
9606.ENSP00000401687 ENSP00000275358 ENSP00000275358 ENSP00000275358 NP_001129396.1.87134 NP_001129396.1.92137 gi|209571555|ref|NP_001129396.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]