SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000278314 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000278314
Domain Number 1 Region: 395-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 451-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 507-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 341-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 2-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-17
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 6 Region: 548-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-16
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 284-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000499
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 8 Region: 228-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000509
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000278314   Gene: ENSG00000149050   Transcript: ENST00000278314
Sequence length 606
Comment pep:known chromosome:GRCh37:11:7020549:7041599:-1 gene:ENSG00000149050 transcript:ENST00000278314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTFEDVTIIFTWEEWKFLDSSQKRLYREVMWENYTNVMSVENWNESYKSQEEKFRYLE
YENFSYWQGWWNAGAQMYENQNYGETVQGTDSKDLTQQDRSQCQEWLILSTQVPGYGNYE
LTFESKSLRNLKYKNFMPWQSLETKTTQDYGREIYMSGSHGFQGGRYRLGISRKNLSMEK
EQKLIVQHSYIPVEEALPQYVGVICQEDLLRDSMEEKYCGCNKCKGIYYWNSRCVFHKRN
QPGENLCQCSICKACFSQRSDLYRHPRNHIGKKLYGCDEVDGNFHQSSGVHFHQRVHIGE
VPYSCNACGKSFSQISSLHNHQRVHTEEKFYKIECDKDLSRNSLLHIHQRLHIGEKPFKC
NQCGKSFNRSSVLHVHQRVHTGEKPYKCDECGKGFSQSSNLRIHQLVHTGEKSYKCEDCG
KGFTQRSNLQIHQRVHTGEKPYKCDDCGKDFSHSSDLRIHQRVHTGEKPYTCPECGKGFS
KSSKLHTHQRVHTGEKPYKCEECGKGFSQRSHLLIHQRVHTGEKPYKCHDCGKGFSHSSN
LHIHQRVHTGEKPYQCAKCGKGFSHSSALRIHQRVHAGEKPYKCREYYKGFDHNSHLHNN
HRRGNL
Download sequence
Identical sequences Q9UL59
gi|156546992|ref|NP_037381.2| NP_037381.2.87134 NP_037381.2.92137 XP_005253185.1.92137 XP_006718371.1.92137 9606.ENSP00000278314 ENSP00000278314 ENSP00000445373 ENSP00000278314 ENSP00000445373 ENSP00000278314 NYSGRC-156546992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]