SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000280871 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000280871
Domain Number 1 Region: 77-411
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.28e-54
Family Glycerol-3-phosphate transporter 0.066
Further Details:      
 
Domain Number 2 Region: 496-606
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000000000000536
Family Glycerol-3-phosphate transporter 0.046
Further Details:      
 
Weak hits

Sequence:  ENSP00000280871
Domain Number - Region: 434-467
Classification Level Classification E-value
Superfamily Plexin repeat 0.051
Family Plexin repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000280871   Gene: ENSG00000151229   Transcript: ENST00000280871
Sequence length 648
Comment pep:known chromosome:GRCh37:12:40148823:40499661:-1 gene:ENSG00000151229 transcript:ENST00000280871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRKASENVEYTLRSLSSLMGERRRKQPEPDAASAAGECSLLAAAESSTSLQSAGAGGGG
VGDLERAARRQFQQDETPAFVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQ
ELLVSSTVGAAAVSALAGGALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLV
VGLGIGIASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRY
MLGLAAVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIE
EEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDD
RLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSP
RITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAW
GRCENETKFKTEDIFWAYNFCPTPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWA
RSTGNACSSGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGK
KLEEIESLFDNRLCTCGTSDSDEGRYIEYIRVKGSNYHLSDNDASDVE
Download sequence
Identical sequences Q96QE2
NP_443117.3.87134 NP_443117.3.92137 9606.ENSP00000280871 gi|203098995|ref|NP_443117.3| ENSP00000280871 ENSP00000280871 ENSP00000280871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]