SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000282296 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000282296
Domain Number 1 Region: 567-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.18e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.31e-25
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 511-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.81e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.37e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 609-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-22
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 7 Region: 29-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 8 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000129
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 9 Region: 233-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000303
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSP00000282296
Domain Number - Region: 171-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0832
Family Classic zinc finger, C2H2 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000282296   Gene: ENSG00000204519   Transcript: ENST00000282296
Sequence length 670
Comment pep:known chromosome:GRCh37:19:58193357:58201167:1 gene:ENSG00000204519 transcript:ENST00000282296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAPVGRRSPPSPRSSMAAVALRDSAQGMTFEDVAIYFSQEEWELLDESQRFLYCDVMLE
NFAHVTSLGYCHGMENEAIASEQSVSIQVRTSKGNTPTQKTHLSEIKMCVPVLKDILPAA
EHQTTSPVQKSYLGSTSMRGFCFSADLHQHQKHYNEEEPWKRKVDEATFVTGCRFHVLNY
FTCGEAFPAPTDLLQHEATPSGEEPHSSSSKHIQAFFNAKSYYKWGEYRKASSHKHTLVQ
HQSVCSEGGLYECSKCEKAFTCKNTLVQHQQIHTGQKMFECSECEESFSKKCHLILHKII
HTGERPYECSDREKAFIHKSEFIHHQRRHTGGVRHECGECRKTFSYKSNLIEHQRVHTGE
RPYECGECGKSFRQSSSLFRHQRVHSGERPYQCCECGKSFRQIFNLIRHRRVHTGEMPYQ
CSDCGKSFSCKSELIQHQRIHSGERPYECRECGKSFRQFSNLIRHRSIHTGDRPYECSEC
EKSFSRKFILIQHQRVHTGERPYECSECGKSFTRKSDLIQHRRIHTGTRPYECSECGKSF
RQRSGLIQHRRLHTGERPYECSECGKSFSQSASLIQHQRVHTGERPYECSECGKSFSQSS
SLIQHQRGHTGERPYECSQCGKPFTHKSDLIQHQRVHTGERPYECSECGKSFSRKSNLIR
HRRVHTEERP
Download sequence
Identical sequences Q7Z340
NP_612356.2.87134 NP_612356.2.92137 ENSP00000282296 ENSP00000282296 ENSP00000282296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]