SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000283309 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000283309
Domain Number 1 Region: 148-256
Classification Level Classification E-value
Superfamily Second domain of FERM 4.58e-30
Family Second domain of FERM 0.0023
Further Details:      
 
Domain Number 2 Region: 54-148
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.69e-16
Family First domain of FERM 0.01
Further Details:      
 
Domain Number 3 Region: 257-387
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000646
Family Third domain of FERM 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000283309   Gene: ENSG00000153303   Transcript: ENST00000283309
Sequence length 549
Comment pep:known chromosome:GRCh37:6:168456425:168479839:-1 gene:ENSG00000153303 transcript:ENST00000283309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPPRGRGIDPARTNPDTFPPSGARCMEPSPERPACSQQEPTLGMDAMASEHRDVLVLL
PSREQLRLAVGVKATGRELFQQVCNVASIRDAQFFGLCVVRNNEYIFMDLEQKLSKYFSK
DWKKERNEGNEKPRAPFVAFLRVQHYVENGRVISDHRARHLYYCHLKERVLRSQCAHREE
AYFLLAACALQADLGEHRESAHAGRYFEPHSYFPQWIITKRGIDYILRHMPTLHRERQGL
SPKEAMLCFIQEACRLEDVPVHFFRLHKDKKEGRPTVILGLALRGVHIYQGKKLEIQLDG
LPAAQKLVYYTGCTWRSRHLLHLLRASHQLHLRVRPTLQQLRQREEAEEKQHYRESYISD
ELELDLASRSFPGSGVSSQHCPHCLSRHSADSHGSSYTSGIKANSWLRESREMSVDVPLE
VHGLHEKEPSSSPRTSRSHPSTRGDSQATRQEPCTQVRTRGQSAEAVHQIQEMTAGVSEE
QHSHGLDDMQLHQLALHPAPTSLSHTFHRALDCRLAGPCETRATLPSKRSSNCLALDLFG
EAPPQEFVV
Download sequence
Identical sequences Q8N878
9606.ENSP00000283309 gi|170932510|ref|NP_079195.3| ENSP00000283309 ENSP00000283309 NP_079195.3.87134 NP_079195.3.92137 ENSP00000283309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]