SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000290759 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000290759
Domain Number 1 Region: 181-249
Classification Level Classification E-value
Superfamily Homeodomain-like 7.27e-18
Family Homeodomain 0.0000547
Further Details:      
 
Domain Number 2 Region: 54-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-16
Family LIM domain 0.022
Further Details:      
 
Domain Number 3 Region: 22-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000015
Family LIM domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSP00000290759
Domain Number - Region: 117-143
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00304
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000290759   Gene: ENSG00000159556   Transcript: ENST00000290759
Sequence length 359
Comment pep:known chromosome:GRCh37:15:76629065:76634817:1 gene:ENSG00000159556 transcript:ENST00000290759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVC
SRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPAL
RPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQ
NKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPP
WKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
Download sequence
Identical sequences G3SG14 H2NNW1 H2Q9V1 Q96A47
ENSGGOP00000027050 9598.ENSPTRP00000012508 9600.ENSPPYP00000007574 9606.ENSP00000290759 ENSPTRP00000012508 gi|21956641|ref|NP_665804.1| ENSP00000290759 ENSP00000290759 NP_665804.1.87134 NP_665804.1.92137 XP_001147206.1.37143 XP_004056619.1.27298 ENSPTRP00000012508 ENSPPYP00000007574 ENSP00000290759 ENSPPYP00000007574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]