SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000291442 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000291442
Domain Number 1 Region: 122-390
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-64
Family Nuclear receptor ligand-binding domain 0.00000625
Further Details:      
 
Domain Number 2 Region: 54-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.76e-31
Family Nuclear receptor 0.0000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000291442   Gene: ENSG00000160113   Transcript: ENST00000291442
Sequence length 404
Comment pep:known chromosome:GRCh37:19:17342694:17356151:-1 gene:ENSG00000160113 transcript:ENST00000291442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCG
DKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVG
MRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYP
AAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWS
ELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSA
EYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPAL
RAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
Download sequence
Identical sequences A0A2J8T6G3 F1D8R3 P10588
gi|20070199|ref|NP_005225.2| 9606.ENSP00000291442 ENSP00000291442 ENSP00000291442 NP_005225.2.87134 NP_005225.2.92137 ENSP00000291442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]