SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000291598 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000291598
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 444-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 220-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.62e-25
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 4 Region: 332-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 490-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.62e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 184-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000816
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000291598   Gene: ENSG00000198440   Transcript: ENST00000291598
Sequence length 569
Comment pep:known chromosome:GRCh37:19:56915383:56936400:1 gene:ENSG00000198440 transcript:ENST00000291598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKDLVTFGDVAVNFSQEEWEWLNPAQRNLYRKVMLENYRSLVSLGVSVSKPDVISLLEQ
GKEPWMVKKEGTRGPCPDWEYVFKNSEFSSKQETYEESSKVVTVGARHLSYSLDYPSLRE
DCQSEDWYKNQLGSQEVHLSQLIITHKEILPEVQNKEYNKSWQTFHQDTIFDIQQSFPTK
EKAHKHEPQKKSYRKKSVEMKHRKVYVEKKLLKCNDCEKVFNQSSSLTLHQRIHTGEKPY
ACVECGKTFSQSANLAQHKRIHTGEKPYECKECRKAFSQNAHLAQHQRVHTGEKPYQCKE
CKKAFSQIAHLTQHQRVHTGERPFECIECGKAFSNGSFLAQHQRIHTGEKPYVCNVCGKA
FSHRGYLIVHQRIHTGERPYECKECRKAFSQYAHLAQHQRVHTGEKPYECKVCRKAFSQI
AYLDQHQRVHTGEKPYECIECGKAFSNSSSLAQHQRSHTGEKPYMCKECRKTFSQNAGLA
QHQRIHTGEKPYECNVCGKAFSYSGSLTLHQRIHTGERPYECKDCRKSFRQRAHLAHHER
IHTMESFLTLSSPSPSTSNQLPRPVGFIS
Download sequence
Identical sequences Q96ND8
9606.ENSP00000291598 ENSP00000291598 ENSP00000388502 ENSP00000291598 ENSP00000388502 gi|229577247|ref|NP_689691.2| gi|229577249|ref|NP_001153333.1| gi|229577396|ref|NP_001153332.1| NP_001153332.1.87134 NP_001153332.1.92137 NP_001153333.1.87134 NP_001153333.1.92137 NP_689691.2.87134 NP_689691.2.92137 XP_011524819.1.92137 XP_016881839.1.92137 ENSP00000291598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]