SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000291750 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000291750
Domain Number 1 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.24e-24
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 4 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 7 Region: 447-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000136
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000291750   Gene: ENSG00000188171   Transcript: ENST00000291750
Sequence length 528
Comment pep:known chromosome:GRCh37:19:20827508:20844402:-1 gene:ENSG00000188171 transcript:ENST00000291750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRNVMLENYSNLVFLGITVSKPDLITCLEQGR
KPLTMKRNEMIAKPSVMCSHFAQDLWPEQSMKDSFQKVVLRRYEKCEHDNLQLKKGCISV
DECKVHKEGYNELNQCLTTTPRKICQCDKYVKVLHQFPNSNGQKRGHTGKKPFKYIECGK
AFKQFSTLTTHKKIHTGGKPYKCEECGKAFNHSCSLTRHKKIHTGEKPYKCEECGKAFKH
SSTLTTHKRNHTGEKPYKCDKCGKAFMSSSTLSKHEIIHTEKKPYKCEECGKAFNRSSTL
TTHKIIHTGEKPYKCEECDKAFKYSYTLTTHKRIHTEDKPYKCEECGKAFKYSSTLTTHK
RIHTGEKPYKCEECGKAFKRSSDLTTHKIIHTGEKPYKCEECGKAFKYSSNLTTHKKIHT
GERPYKCEECGKAFNQSSILTTHRRIHTGEKFYKCEECGKAFKCSSNLTTHKKIHTGERP
YKCEECGKAFNQSSILTTHERIILERNSTNVKNVAKPSSGPHTLLHIR
Download sequence
Identical sequences Q68DY1
gi|115527110|ref|NP_001070143.1| ENSP00000469958 ENSP00000291750 ENSP00000458447 ENSP00000460919 ENSP00000469958 NP_001070143.1.87134 NP_001070143.1.92137 9606.ENSP00000376118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]