SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000292841 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000292841
Domain Number 1 Region: 670-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 558-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 502-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 614-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 362-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.7e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 418-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 250-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 22-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 9 Region: 166-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 10 Region: 712-764
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 11 Region: 292-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 12 Region: 128-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000264
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 465-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000987
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 14 Region: 214-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000119
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSP00000292841
Domain Number - Region: 95-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0227
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000292841   Gene: ENSG00000196967   Transcript: ENST00000292841
Sequence length 769
Comment pep:known chromosome:GRCh37:19:37641004:37663615:-1 gene:ENSG00000196967 transcript:ENST00000292841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPANWTSPQKSSALAPEDHGSSYEGSVSFRDVAIDFSREEWRHLDPSQRNLYRDVMLETY
SHLLSVGYQVPEAEVVMLEQGKEPWALQGERPRQSCPGEKLWDHNQCRKILSYKQVSSQP
QKMYPGEKAYECAKFEKIFTQKSQLKVHLKVLAGEKLYVCIECGKAFVQKPEFIIHQKTH
MREKPFKCNECGKSFFQVSSLFRHQRIHTGEKLYECSQCGKGFSYNSDLSIHEKIHTGER
HHECTDCGKAFTQKSTLKMHQKIHTGERSYICIECGQAFIQKTHLIAHRRIHTGEKPYEC
SNCGKSFISKSQLQVHQRVHTRVKPYICTEYGKVFSNNSNLVTHKKVQSREKSSICTECG
KAFTYRSELIIHQRIHTGEKPYECSDCGKAFTQKSALTVHQRIHTGEKSYICMKCGLAFI
QKAHLIAHQIIHTGEKPHKCGHCGKLFTSKSQLHVHKRIHTGEKPYMCNKCGKAFTNRSN
LITHQKTHTGEKSYICSKCGKAFTQRSDLITHQRIHTGEKPYECNTCGKAFTQKSHLNIH
QKIHTGERQYECHECGKAFNQKSILIVHQKIHTGEKPYVCTECGRAFIRKSNFITHQRIH
TGEKPYECSDCGKSFTSKSQLLVHQPVHTGEKPYVCAECGKAFSGRSNLSKHQKTHTGEK
PYICSECGKTFRQKSELITHHRIHTGEKPYECSDCGKSFTKKSQLQVHQRIHTGEKPYVC
AECGKAFTDRSNLNKHQTTHTGDKPYKCGICGKGFVQKSVFSVHQSSHA
Download sequence
Identical sequences Q6P3V2
ENSP00000349440 ENSP00000292841 NP_001275729.1.87134 NP_001275729.1.92137 ENSP00000292841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]