SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000293725 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000293725
Domain Number 1 Region: 265-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-22
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 2 Region: 205-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 3 Region: 317-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-19
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-18
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 5 Region: 375-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.19e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 163-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 415-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-16
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 131-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000846
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSP00000293725
Domain Number - Region: 84-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00071
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000293725   Gene: ENSG00000188868   Transcript: ENST00000293725
Sequence length 476
Comment pep:known chromosome:GRCh37:19:12428291:12444502:-1 gene:ENSG00000188868 transcript:ENST00000293725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAVAFEDVAVNFTQEEWALLGPSQKNLYRYVMQETIRNLDCIRMIWEEQNTEDQYKNPR
RNLRCHMVERFSESKDSSQCGETFSLIRDSIVNNSICPGEDPCQSAECEEVIMGHLSLNS
HIRVDSGHKPHEYQEYGEKPHTHKQRGKAFSYHHSFQSRGRPHTGKKRYECKECGKTFSS
RRNLRRHMVVQGGNRPYKCKLCGKAFFWPSLLRMHERTHTGEKPYECKQCSKAFPFYSSY
RRHERMHTGEKPYECKQCSKALPDSSSYIRHERTHTGEKPYTCKQCGKAFSVSSSLRRHE
TTHSAEKPYECKQCGKTFHHLGSFQIHMKRHTGDRPHKCKICGKGFDRPSLVRYHERIHT
GEKPYECKQCGKTLSHSSSFRRHMIMHTGGGPHKCKICGKAFVYPSVCQRHEKSHSGEKP
YECKQCGKALSHSSSFRRHMVMHTGDGPNKCKVCGKAFVYPSVCQRHEKTHWRETI
Download sequence
Identical sequences Q8TA94
9606.ENSP00000293725 NP_660319.1.87134 NP_660319.1.92137 ENSP00000293725 gi|21687237|ref|NP_660319.1| ENSP00000293725 ENSP00000293725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]