SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000298352 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000298352
Domain Number 1 Region: 7-147
Classification Level Classification E-value
Superfamily Globin-like 8.44e-48
Family Globins 0.00000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000298352   Gene: ENSG00000165553   Transcript: ENST00000298352
Sequence length 151
Comment pep:known chromosome:GRCh37:14:77731826:77737655:-1 gene:ENSG00000165553 transcript:ENST00000298352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPE
FLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKC
LGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Download sequence
Identical sequences A0A1K0FUC2 A0A2K5PS41 A0M8W9 G1S403 Q3KN66 Q9NPG2
ENSP00000298352 ENSNLEP00000020241 gi|10864065|ref|NP_067080.1| NP_001030585.1.37143 NP_067080.1.87134 NP_067080.1.92137 XP_003260844.1.23891 XP_003808912.1.60992 XP_017384045.1.71028 ENSP00000298352 ENSPTRP00000011169 ENSPTRP00000011169 cath|current|4mpmA00/3-149 cath|current|4mpmB00/2-149 4mpm_A 4mpm_B 9598.ENSPTRP00000011169 9606.ENSP00000298352 ENSNLEP00000020241 ENSP00000298352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]