SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000301480 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000301480
Domain Number 1 Region: 8-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-24
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 2 Region: 107-165
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.07e-23
Family KRAB domain (Kruppel-associated box) 0.00069
Further Details:      
 
Domain Number 3 Region: 580-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 357-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-20
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 5 Region: 496-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-20
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 6 Region: 734-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.61e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 692-749
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-17
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 8 Region: 636-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-17
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 9 Region: 400-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 320-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000121
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 11 Region: 544-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000351
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 281-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000478
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 13 Region: 450-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000581
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSP00000301480
Domain Number - Region: 209-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0596
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000301480   Gene: ENSG00000198028   Transcript: ENST00000301480
Sequence length 790
Comment pep:known chromosome:GRCh37:19:9577183:9609283:-1 gene:ENSG00000198028 transcript:ENST00000301480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYCLTNCYQYSVTFEDTAVDFTQEEWILLDPVQRNLYRDVMLENYENVAKVGFQLFKPS
VISWLEEEELRTLQQGVLQDWAIKHQTSVSALQQEFWKIQTSNGIQMDLVTFDSVAVEFT
QEEWTLLDPAQRNLYSDVMLENYKNLSSVGYQLFKPSLISWLEEEEELSTLPRVLQEWKM
CLKTKGPALWQDNFCLKTLNGIQLARNQNGEELYDCKQCEDVFCKHPCLKTNMSTQNRGN
TSECIQYAKDLLSLYNKTSTIRKVSVFSKHGKSFRLILNVQVQRKCTQDKSFEGTDYGKA
FIYQSYLEAHRKTQSGEKLNEWKQCGEAFTHSTSHAVNVETHIIKNPYECKECGKDFRYP
THLNNHMQTHIGIKPYKCKHCGKTFTVPSGFLEHVRTHTGEKPYGCKECGKAFGTSAGLI
EHIRCHAREKTFKCDHCGKAFISYPSLFGHLRVHNGEKPYEHKEYGKAFGTSSGVIEDRR
SNTGQKRFDCDQCGKVFVSFSSLFAHLRTHTGEKPFKCYKCGKPFTSSACLRIHMRTHTE
ERLYQCKKCGKAFTKCSYLTKHLRTHAGEKPYECMKCGKAFTERSYLTKHLRRHSGEKPY
ECKKCGKAFTERSDLTKHLRRHTGDKPYEYKDCGKAFVVSSSLVDHLRTHTGYKPYKCNA
CEKAYSRSCVLTQHLKTHAAEKTSECNACGNSFRNSMCFHDRLKTLTKIKPYKCKDCGKA
FTCHSDLTNHVRIHTGEKPYKCKECGKAFRTSSGRIQHLRTHMGEKPFECDQCGKAFASF
SARIAHLKTH
Download sequence
Identical sequences Q96MR9
ENSP00000301480 9606.ENSP00000301480 NP_689689.2.87134 NP_689689.2.92137 XP_011525998.1.92137 XP_011525999.1.92137 XP_016881816.1.92137 XP_016881817.1.92137 XP_016881818.1.92137 gi|124517687|ref|NP_689689.2| ENSP00000301480 ENSP00000301480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]