SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000301744 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000301744
Domain Number 1 Region: 193-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.29e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 155-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000116
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 339-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000127
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 234-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000466
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 5 Region: 10-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000017
Family KRAB domain (Kruppel-associated box) 0.0099
Further Details:      
 
Domain Number 6 Region: 377-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000194
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000301744   Gene: ENSG00000167981   Transcript: ENST00000301744
Sequence length 424
Comment pep:known chromosome:GRCh37:16:3486104:3493542:-1 gene:ENSG00000167981 transcript:ENST00000301744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASMPPTPEAQGPILFEDLAVYFSQEECVTLHPAQRSLSKDGTKESLEDAALMGEEGKPE
INQQLSLESMELDELALEKYPIAAPLVPYPEKSSEDGVGNPEAKILSGTPTYKRRVISLL
VTIENHTPLVELSEYLGTNTLSEILDSPWEGAKNVYKCPECDQNFSDHSYLVLHQKIHSG
EKKHKCGDCGKIFNHRANLRTHRRIHTGEKPYKCAKCSASFRQHSHLSRHMNSHVKEKPY
TCSICGRGFMWLPGLAQHQKSHSAENTYESTNCDKHFNEKPNLALPEETFVSGPQYQHTK
CMKSFRQSLYPALSEKSHDEDSERCSDDGDNFFSFSKFKPLQCPDCDMTFPCFSELISHQ
NIHTEERPHKCKTCEESFALDSELACHQKSHMLAEPFKCTVCGKTFKSNLHLITHKRTHI
KNTT
Download sequence
Identical sequences Q96LX8
gi|22748967|ref|NP_689670.1| ENSP00000301744 NP_689670.1.87134 NP_689670.1.92137 ENSP00000301744 ENSP00000301744 9606.ENSP00000301744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]