SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000305071 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000305071
Domain Number 1 Region: 93-241
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.71e-36
Family Ankyrin repeat 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000305071   Gene: ENSG00000064490   Transcript: ENST00000303088
Sequence length 260
Comment pep:known chromosome:GRCh37:19:19303052:19312675:1 gene:ENSG00000064490 transcript:ENST00000303088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSS
PQAGSSLKHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELDQLKEHLRKGDNLVNKP
DERGFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERD
VDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQ
VIENHILKLFQSNLVPADPE
Download sequence
Identical sequences A0A024R7M1 O14593
9606.ENSP00000305071 ENSP00000305071 ENSP00000305071 ENSP00000384572 NP_003712.1.87134 NP_003712.1.92137 XP_005260191.1.92137 XP_005260192.1.92137 XP_016882904.1.92137 gi|4506499|ref|NP_003712.1| ENSP00000305071 ENSP00000384572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]