SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000306697 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000306697
Domain Number - Region: 49-100
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0572
Family Cytochrome c3-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000306697   Gene: ENSG00000170262   Transcript: ENST00000303645
Sequence length 172
Comment pep:known chromosome:GRCh37:21:33671161:33684601:1 gene:ENSG00000170262 transcript:ENST00000303645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM
SWSASPQMRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPD
QPLRQESSSTLPLGGFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS
Download sequence
Identical sequences Q8TCY5
NP_848932.1.87134 NP_848932.1.92137 XP_006724091.1.92137 ENSP00000306697 ENSP00000382684 gi|30520312|ref|NP_848932.1| ENSP00000306697 ENSP00000306697 ENSP00000382684 9606.ENSP00000306697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]