SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000308578 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000308578
Domain Number 1 Region: 381-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 436-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.57e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 31-90
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-23
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 6 Region: 492-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.43e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 185-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.04e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 343-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000391
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000308578   Gene: ENSG00000196705   Transcript: ENST00000311048
Sequence length 576
Comment pep:known chromosome:GRCh37:19:21324840:21368805:1 gene:ENSG00000196705 transcript:ENST00000311048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDLKYGVYPLKEASGCPGAERNLLVYSYFEKETLTFRDVAIEFSLEEWECLNPAQQNLY
MNVMLENYKNLVFLGVAVSKQDPVTCLEQEKEPWNMKRHEMVDEPPAMCSYFTKDLWPEQ
DIKDSFQQVILRRYGKCEHENLQLRKGSASVDEYKVHKEGYNELNQCLTTTQSKIFPCDK
YVKVFHKFLNANRHKTRHTGKKPFKCKKCGKSFCMLLHLSQHKRIHIRENSYQCEECGKA
FKWFSTLTRHKRIHTGEKPFKCEECGKAFKQSSTLTTHKIIHTGEKPYRCEECGKAFNRS
SHLTTHKIIHTGEKPYKCEECGKAFNQSSTLSTHKFIHAGEKPYKCEECDKAFNRFSYLT
KHKIIHTGEKSYKCEECGKGFNWSSTLTKHKRIHTGEKPYKCEVCGKAFNESSNLTTHKM
IHTGEKPYKCEECGKAFNRSPQLTAHKIIHTGEKPYKCEECGKAFSQSSILTTHKRIHTG
EKPYKCEECGKAFNRSSNLTKHKIIHTGEKSYKCEECGKAFNQSSTLTKHRKIHTRQKPY
NCEECDNTFNQSSNLIKQNNSYWRETLQMSRMWESL
Download sequence
Identical sequences A0A024R7Q8 Q8TF32
ENSP00000308578 ENSP00000308578 NP_597730.2.87134 NP_597730.2.92137 9606.ENSP00000308578 gi|194239711|ref|NP_597730.2| ENSP00000308578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]