SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000309161 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000309161
Domain Number 1 Region: 523-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-27
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 411-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.63e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 467-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.57e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 242-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.25e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 186-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 354-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 9 Region: 567-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000309161   Gene: ENSG00000196263   Transcript: ENST00000308031
Sequence length 626
Comment pep:known chromosome:GRCh37:19:57019212:57041590:1 gene:ENSG00000196263 transcript:ENST00000308031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVEVVKVMPQDLVTFKDVAIDFSQEEWQWMNPAQKRLYRSMMLENYQSLVSLGLCISKP
YVISLLEQGREPWEMTSEMTRSPFSDWESIYVTQELPLKQFMYDDACMEGITSYGLECST
FEENWKWEDLFEKQMGSHEMFSKKEIITHKETITKETEFKYTKFGKCIHLENIEESIYNH
TSDKKSFSKNSMVIKHKKVYVGKKLFKCNECDKTFTHSSSLTVHFRIHTGEKPYACEECG
KAFKQRQHLAQHHRTHTGEKLFECKECRKAFKQSEHLIQHQRIHTGEKPYKCKECRKAFR
QPAHLAQHQRIHTGEKPYECKECGKAFSDGSSFARHQRCHTGKRPYECIECGKAFRYNTS
FIRHWRSYHTGEKPFNCIDCGKAFSVHIGLILHRRIHTGEKPYKCGVCGKTFSSGSSRTV
HQRIHTGEKPYECDICGKDFSHHASLTQHQRVHSGEKPYECKECGKAFRQNVHLVSHLRI
HTGEKPYECKECGKAFRISSQLATHQRIHTGEKPYECIECGNAFKQRSHLAQHQKTHTGE
KPYECNECGKAFSQTSNLTQHQRIHTGEKPYKCTECGKAFSDSSSCAQHQRLHTGQRPYQ
CFECGKAFRRKLSLICHQRSHTGEEP
Download sequence
Identical sequences A0A024R4Q9 Q9BX82
NP_065864.2.87134 NP_065864.2.92137 XP_011525450.1.92137 ENSP00000309161 ENSP00000309161 ENSP00000309161 gi|150170667|ref|NP_065864.2| 9606.ENSP00000309161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]