SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000309330 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000309330
Domain Number 1 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.57e-26
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 10-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 246-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.1e-22
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 5 Region: 190-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-20
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 6 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 7 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 152-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000373
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000309330   Gene: ENSG00000173041   Transcript: ENST00000309683
Sequence length 530
Comment pep:known chromosome:GRCh37:7:63980262:64023484:-1 gene:ENSG00000173041 transcript:ENST00000309683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPPGSLEMGPLTFRDVAIEFSLEEWQCLDTAQRNLYRKVMFENYRNLVFLGIAVSKPH
LITCLEQGKEPWNRKRQEMVAKPPVIYSHFTEDLWPEHSIKDSFQKVILRGYGKCGHENL
QLRISCKSVDESKVFKEGYNELNQCLRTTQSKIFQCDKYVKVFHKFSNSNSHKKRNTGKK
VFKCKECGKSFCMLSHLTQHIRIHTRENSYKCEECGKVLNWFSELIKHKGIHMGEKPYKC
EECGKAFNQSSTLIKHKKIHIEEKPFKCEECGKAFSLFSILSKHKIIHTGDKPYKCDECH
KAFNWFATLTNHKRIHTGEKPFKCEECGKDFNQFSNLTKHKKIHTGEKPYKCEECGKAFN
QFANLTRHKKIHTGEKSYKCEECGKAFIQSSNLTEHMRIHTGEKPYKCEECGKAFNGCSS
LTRHKRIHTRENTYKCEECGKGFTLFSTLTNHKVIHTGEKSYKCDECGNVFNWPATLANH
KRIHAREKPYKCEECGKAFNRSSHLTRHKKIHTGEKLYKPEKCDNNFDNT
Download sequence
Identical sequences Q8NEM1
ENSP00000309330 gi|194097407|ref|NP_848653.2| 9606.ENSP00000309330 NP_848653.2.87134 NP_848653.2.92137 ENSP00000309330 ENSP00000309330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]