SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000309365 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000309365
Domain Number 1 Region: 76-182
Classification Level Classification E-value
Superfamily WWE domain 4.71e-33
Family WWE domain 0.00000111
Further Details:      
 
Domain Number 2 Region: 36-81
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000683
Family RING finger domain, C3HC4 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000309365   Gene: ENSG00000118518   Transcript: ENST00000309649
Sequence length 359
Comment pep:known chromosome:GRCh37:6:127588020:127609502:1 gene:ENSG00000118518 transcript:ENST00000309649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAGCGEIDHSINMLPTNRKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLC
VKGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDER
TSRELEDAFSKGKKNTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAG
LRLDCDANTVNLARESSADGADSVSAQSGASVQPLVSSVRPLTSVDGQLTSPATPSPDAS
TSLEDSFAHLQLSGDNTAERSHRGEGEEDHESPSSGRVPAPDTSIEETESDASSDSEDVS
AVVAQHSLTQQRLLVSNANQTVPDRSDRSGTDRSVAGGGTVSVSVRSRRPDGQCTVTEV
Download sequence
Identical sequences H2QTP9 Q9NTX7
gi|338827729|ref|NP_001229778.1| gi|338827731|ref|NP_001229779.1| gi|338827733|ref|NP_001229780.1| ENSP00000357297 ENSP00000476814 ENSP00000479890 NP_001229778.1.87134 NP_001229778.1.92137 NP_001229779.1.87134 NP_001229779.1.92137 NP_001229780.1.87134 NP_001229780.1.92137 XP_001166814.2.37143 XP_003827669.1.60992 XP_003827670.1.60992 XP_016866825.1.92137 XP_518728.3.37143 ENSPTRP00000031718 ENSP00000309365 9598.ENSPTRP00000031718 ENSPTRP00000031718 ENSP00000357297 ENSP00000476814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]