SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000310033 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000310033
Domain Number 1 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 203-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.13e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 3-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 5 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 445-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 7 Region: 148-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000459
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 8 Region: 250-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000082
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 9 Region: 105-157
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000102
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000310033   Gene: ENSG00000172748   Transcript: ENST00000308811
Sequence length 504
Comment pep:known chromosome:GRCh37:8:182200:197342:1 gene:ENSG00000172748 transcript:ENST00000308811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPDSMTFEDIIVDFTQEEWALLDTSQRKLFQDVMLENISHLVSIGKQLCKSVVLSQLE
QVEKLSTQRISLLQGREVGIKHQEIPFIQHIYQKGTSTISTMRSHTQEDPFLCNDLGEDF
TQHIALTQNVITYMRTKHFVSKKFGKIFSDWLSFNQHKEIHTKCKSYGSHLFDYAFIQNS
ALRPHSVTHTREITLECRVCGKTFSKNSNLRRHEMIHTGEKPHGCHLCGKAFTHCSDLRK
HERTHTGEKPYGCHLCGKAFSKSSNLRRHEMIHTREKAQICHLCGKAFTHCSDLRKHERT
HLGDKPYGCLLCGKAFSKCSYLRQHERTHNGEKPYECHLCGKAFSHCSHLRQHERSHNGE
KPHGCHLCGKAFTESSVLKRHERIHTGEKPYECHVCGKAFTESSDLRRHERTHTGEKPYE
CHLCGKAFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHRRVHTGEKPYVCPLC
GKAFSKFFNLRQHERTHTKKAMNM
Download sequence
Identical sequences Q8TC21
ENSP00000310033 ENSP00000381613 ENSP00000310033 ENSP00000310033 ENSP00000318719 ENSP00000381613 NP_001035880.1.87134 NP_001035880.1.92137 NP_001035881.1.87134 NP_001035881.1.92137 NP_001274183.1.87134 NP_001274183.1.92137 NP_001274184.1.87134 NP_001274184.1.92137 NP_001274185.1.87134 NP_001274185.1.92137 NP_775810.2.87134 NP_775810.2.92137 XP_016868655.1.92137 gi|109240540|ref|NP_775810.2| gi|109240542|ref|NP_001035880.1| gi|109240544|ref|NP_001035881.1| 9606.ENSP00000310033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]