SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000310928 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000310928
Domain Number 1 Region: 176-440
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.05e-87
Family Nuclear receptor ligand-binding domain 0.000000000131
Further Details:      
 
Domain Number 2 Region: 71-154
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.46e-27
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000310928   Gene: ENSG00000112033   Transcript: ENST00000311565
Sequence length 441
Comment pep:known chromosome:GRCh37:6:35310391:35395955:1 gene:ENSG00000112033 transcript:ENST00000311565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
Download sequence
Identical sequences A0A024RCW6 Q03181
ENSP00000310928 ENSP00000353916 9606.ENSP00000310928 ENSP00000310928 ENSP00000310928 ENSP00000353916 gi|284807155|ref|NP_001165289.1| gi|5453940|ref|NP_006229.1| NP_001165289.1.87134 NP_001165289.1.92137 NP_006229.1.87134 NP_006229.1.92137 XP_005249250.1.92137 XP_006715183.1.92137 XP_006715186.1.92137 XP_011513009.1.92137 XP_011513011.1.92137 XP_011513012.1.92137 XP_016866460.1.92137 XP_016866461.1.92137 XP_016866462.1.92137 XP_016866463.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]