SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000311596 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000311596
Domain Number 1 Region: 15-75
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.71e-26
Family KRAB domain (Kruppel-associated box) 0.00074
Further Details:      
 
Domain Number 2 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.34e-23
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.21e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 203-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-18
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 8 Region: 581-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.99e-18
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 9 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-17
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSP00000311596
Domain Number - Region: 150-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0031
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000311596   Gene: ENSG00000196110   Transcript: ENST00000308650
Sequence length 642
Comment pep:known chromosome:GRCh37:19:9404951:9415795:-1 gene:ENSG00000196110 transcript:ENST00000308650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEERKTAELQKNRIQDSVVFEDVAVDFTQEEWALLDLAQRNLYRDVMLENFQNLASLGY
PLHTPHLISQWEQEEDLQTVKRELIQGIFMGEHREGFETQLKTNESVASQDICGEKISNE
QKIVRFKRNDSWFSSLHENQESCGIDYQNKSHERHLRNHMVENIYECYEENQDGQTFSQV
PNLDSLKRNTEVKSCECHECGKAFVDHSSLKSHIRSHTGSKPYQCKECGKAFHFLACFKK
HMKTPTEEKPYECKECTKAFSCSSFFRAHMKIHIGKTNYECKECGKGFSCSSSLTEHKRI
HSGDKPYECKECGKAFSCSSSLSKHKRIHSGDKPYECKECGKAFSSSSHLIIHIRIHTGE
KPYECKECGKAFSESSKLTVHGRTHTGEKPYKCKECGKAYNCPSSLSIHMRKHTGEKPYE
CLECGKAFYLPTSLNTHVKNQSREKPYECKECGKAFSCPSSFRAHVRDHTGKIQYECKEC
GKTFSRSSSLTEHLRTHSGEKPYECKECGKAFISSSHLTVHIRTHTGEKPYECKKCGKAF
IYPSALRIHMRTHTGEKPYECKECGKAFRHSSYLTVHARMHTGEKPFECLECGKAFSCPS
SFRRHVRSHTGEKPYECKECGKAFVCPAYFRRHVKTHTRENI
Download sequence
Identical sequences Q32M78
gi|110626177|ref|NP_940937.1| ENSP00000311596 ENSP00000467723 ENSP00000311596 9606.ENSP00000311596 ENSP00000311596 ENSP00000467723 NP_940937.1.87134 NP_940937.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]