SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000321386 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000321386
Domain Number 1 Region: 89-400
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000294
Family 28-residue LRR 0.042
Further Details:      
 
Domain Number 2 Region: 8-67
Classification Level Classification E-value
Superfamily F-box domain 0.000000000419
Family F-box domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000321386   Gene: ENSG00000177294   Transcript: ENST00000321535
Sequence length 442
Comment pep:known chromosome:GRCh37:17:6679542:6690965:1 gene:ENSG00000177294 transcript:ENST00000321535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEESELIQPQDQSCWAFLPDLCLCRVFWWLGDRDRSRAALVCRKWNQMMYSAELWRYRT
ITFSGRPSRVHASEVESAVWYVKKFGRYLEHLEVKFMNPYNAVLTKKFQVTMRGLLSCLS
KSNNRLKSLSIQYLELDRLVWRNSIRSSFISSLSFFLKKMGKRLDYLNLKGARLTVEQGC
QILDSLSYMRNENVISELNIEDYFSHHLAVYNSPQFKKTMSTFHNLVSLNLNYNCISDEL
LENLCENASTLRTINIKCHVHDPHGQVIWGMSWAKLARQATNLKVNFFFERIMKYERLAR
ILLQEIPIRSISLRSCYFSDPDCSMRPTLIDLLPTFRHTLQKLTCEFNNNHESLDEELHL
LIISCRKLFYFKIWAFLDVSFVERILKSQKERQCALRVFKARIYTNRYETNEEDKTLQEI
YRKYRKLIESELSYFVIVYSVM
Download sequence
Identical sequences Q8N4B4
9606.ENSP00000321386 ENSP00000321386 ENSP00000321386 NP_694962.1.87134 NP_694962.1.92137 XP_011521999.1.92137 gi|23397500|ref|NP_694962.1| ENSP00000321386 NYSGRC-23397500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]