SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000322872 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000322872
Domain Number 1 Region: 43-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.01e-37
Family SCAN domain 0.0000713
Further Details:      
 
Domain Number 2 Region: 355-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 585-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 537-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 400-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-16
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 771-823
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.93e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 698-751
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.71e-16
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 8 Region: 221-261
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000327
Family KRAB domain (Kruppel-associated box) 0.0023
Further Details:      
 
Domain Number 9 Region: 642-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000155
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSP00000322872
Domain Number - Region: 743-769
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00857
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000322872   Gene: ENSG00000196652   Transcript: ENST00000326775
Sequence length 839
Comment pep:known chromosome:GRCh37:7:99102274:99131407:1 gene:ENSG00000196652 transcript:ENST00000326775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPTFETFYQRFRHFQYHE
ASGPREALSQLRVLCCEWLRPELHTKEQILELLVLEQFLTILPEEFQPWVREHHPESGEE
AVAVIENIQRELEERRQQIVACPDVLPRKMATPGAVQESCSPHPLTVDTQPEQAPQKPRL
LEENALPVLQVPSLPLKDSQELTASLLSTGSQKLVKIEEVADVAVSFILEEWGHLDQSQK
SLYRDDRKENYGSITSMGYESRDNMELIVKQISDDSESHWVAPEHTERSVPQDPDFAEVS
DLKGMVQRWQVNPTVGKSRQNPSQKRDLDAITDISPKQSTHGERGHRCSDCGKFFLQASN
FIQHRRIHTGEKPFKCGECGKSYNQRVHLTQHQRVHTGEKPYKCQVCGKAFRVSSHLVQH
HSVHSGERPYGCNECGKNFGRHSHLIEHLKRHFREKSQRCSDKRSKNTKLSVKKKISEYS
EADMELSGKTQRNVSQVQDFGEGCEFQGKLDRKQGIPMKEILGQPSSKRMNYSEVPYVHK
KSSTGERPHKCNECGKSFIQSAHLIQHQRIHTGEKPFRCEECGKSYNQRVHLTQHQRVHT
GEKPYTCPLCGKAFRVRSHLVQHQSVHSGERPFKCNECGKGFGRRSHLAGHLRLHSREKS
HQCRECGEIFFQYVSLIEHQVLHMGQKNEKNGICEEAYSWNLTVIEDKKIELQEQPYQCD
ICGKAFGYSSDLIQHYRTHTAEKPYQCDICRENVGQCSHTKQHQKIYSSTKSHQCHECGR
GFTLKSHLNQHQRIHTGEKPFQCKECGMNFSWSCSLFKHLRSHERTDPINTLSVEGSLL
Download sequence
Identical sequences Q9Y2L8
9606.ENSP00000322872 ENSP00000322872 ENSP00000377725 ENSP00000392104 gi|11036642|ref|NP_055384.1| gi|21483182|ref|NP_659570.1| ENSP00000322872 hso003005608.3 ENSP00000322872 ENSP00000377725 ENSP00000392104 NP_001305011.1.87134 NP_001305011.1.92137 NP_055384.1.87134 NP_055384.1.92137 NP_659570.1.87134 NP_659570.1.92137 XP_016867407.1.92137 XP_016867408.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]