SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000324518 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000324518
Domain Number 1 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.49e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 466-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 34-92
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.8e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 242-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.19e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 410-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 508-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.09e-18
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 8 Region: 190-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000162
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000324518   Gene: ENSG00000198039   Transcript: ENST00000319636
Sequence length 569
Comment pep:known chromosome:GRCh37:7:64363631:64389416:1 gene:ENSG00000198039 transcript:ENST00000319636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAPRGPPSVAPLPAGIGRSTAKTPGLPGSLEMGPLTFRDVAIEFSLEEWQCLDTSQQN
LYRNVMLDNYRNLVFLGIAVSKPDLITCLEQGKEPCNMKRHAMVAKPPVVCSHFAQDLWP
KQGLKDSFQKVILRRYGKYGHENLQLRKGCKSADEHKVHKRGYNGLNQCLTTTQSKIFQC
DKYVKVLHKFSNSNIHKKRQTGKKPFKCKECGKSCCILSQLTQHKKTATRVNFYKCKTCG
KAFNQFSNLTKHKIIHPEVNPYKCEECGKAFNQSLTLTKHKKIHTEEKPYKCEDCGKVFS
VFSVLTKHKIIHTGTKPYNCEECGKGFSIFSTLTKHKIIHTGEKPYKCNECGKAFNWSST
LTKHKRIHTGEKPYKCEECGKAFNQSSTLTRHKIVHTGEKPYKCEECGKAFKRSTTLTKH
KRIYTKEKPYKCEECGKAFSVFSTLTKHKIIHTGAKPYKCEECGSAFRAFSTLTEHKRVH
TGEKPYKCNECGKAFNWSSTLTKHKRIHTGEKPYKCEECGKAFNRSSNLTRHKKIHTGEK
PYKPKRCDSAFDNTPNFSRHKRNHMGEKS
Download sequence
Identical sequences Q14593
ENSP00000324518 9606.ENSP00000418719 ENSP00000418719 NP_066971.2.87134 NP_066971.2.92137 XP_016867177.1.92137 ENSP00000418719 gi|110349778|ref|NP_066971.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]