SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000325819 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000325819
Domain Number 1 Region: 152-407
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.07e-70
Family Nuclear receptor ligand-binding domain 0.00000774
Further Details:      
 
Domain Number 2 Region: 84-164
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.05e-31
Family Nuclear receptor 0.0000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000325819   Gene: ENSG00000175745   Transcript: ENST00000327111
Sequence length 423
Comment pep:known chromosome:GRCh37:5:92919043:92930321:1 gene:ENSG00000175745 transcript:ENST00000327111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGA
PATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTY
TCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLN
GHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFF
PDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIR
IFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQY
PNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSI
QCS
Download sequence
Identical sequences A0A0D9RQ67 A0A2I3LQB9 A0A2I3TGT9 A0A2J8TD40 A0A2K5P7P2 A0A2K5Q289 A0A2K5VYC5 I2CYU1 P10589
gi|5032173|ref|NP_005645.1| ENSP00000325819 NP_005645.1.87134 NP_005645.1.92137 XP_005557421.1.63531 XP_007976647.1.81039 XP_011944428.1.92194 XP_014995899.1.72884 XP_017369492.1.71028 XP_517657.3.37143 ENSPVAP00000013897 ENSP00000325819 ENSPTRP00000046378 ENSPVAP00000013897 ENSPTRP00000046378 ENSP00000325819 HR3061 9598.ENSPTRP00000046378 9606.ENSP00000325819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]