SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000326249 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000326249
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.12e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-23
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 252-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 462-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.18e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 214-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.14e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 8 Region: 151-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000123
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000326249   Gene: ENSG00000178187   Transcript: ENST00000320129
Sequence length 522
Comment pep:known chromosome:GRCh37:5:178368192:178393434:1 gene:ENSG00000178187 transcript:ENST00000320129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSHLPTMVQESVTFKDVAILFTQEEWGQLSPAQRALYRDVMLENYSNLVSLGLLGPKP
DTFSQLEKREVWMPEDTPGGFCLDWMTMPASKKSTVKAEIPEEELDQWTIKERFSSSSHW
KCASLLEWQCGGQEISLQRVVLTHPNTPSQECDESGSTMSSSLHSDQSQGFQPSKNAFEC
SECGKVFSKSSTLNKHQKIHNEKNANQKIHIKEKRYECRECGKAFHQSTHLIHHQRIHTG
EKPYECKECGKAFSVSSSLTYHQKIHTGEKPFECNLCGKAFIRNIHLAHHHRIHTGEKPF
KCNICEKAFVCRAHLTKHQNIHSGEKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNE
CGKAFRVNSSLTEHQRIHTGEKPYKCNECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKA
FRDQSALAQHQRIHTGEKPYTCNICEKAFSDHSALTQHKRIHTREKPYKCKICEKAFIRS
THLTQHQRIHTGEKPYKCNKCGKAFNQTANLIQHQRHHIGEK
Download sequence
Identical sequences Q8N9F8
ENSP00000326249 ENSP00000430354 ENSP00000326249 NP_001171560.1.87134 NP_001171560.1.92137 NP_001171561.1.87134 NP_001171561.1.92137 NP_001310235.1.87134 NP_001310235.1.92137 NP_872400.2.87134 NP_872400.2.92137 ENSP00000326249 ENSP00000430354 9606.ENSP00000326249 gi|296010893|ref|NP_872400.2| gi|296010895|ref|NP_001171560.1| gi|296010897|ref|NP_001171561.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]