SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000332134 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000332134
Domain Number 1 Region: 162-424
Classification Level Classification E-value
Superfamily RNI-like 6.08e-19
Family 28-residue LRR 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000332134   Gene: ENSG00000116721   Transcript: ENST00000332296
Sequence length 474
Comment pep:known chromosome:GRCh37:1:12851546:12856777:1 gene:ENSG00000116721 transcript:ENST00000332296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIQAPPRLLELAGQSLLRDQALSISAMEELPRVLYLPLFMEAFSRRHFQTLTVMVQAWP
FTCLPLGSLMKTLHLETLKALLEGLHMLLTQKDRPRRWKLQVLDLRDVDENFWARWPGAW
ALSCFPETTSKRQTAEDCPRMGEHQPLKVFIDICLKEIPQDECLRYLFQWVYQRRGLVHL
CCSKLVNYLTPIKYLRKSLKIIYLNSIQELEIRNMSWPRLIRKLRCYLKEMKNLRKLVFS
RCHHYTSDNELQGRLVAKFSSVFLRLEHLQLLKIKLITFFSGHLEQLIRCLQNPLENLEL
TYGYLLEEDMKCLSQYPSLGYLKHLNLSYVLLFRISLEPLGALLEKIAASLKTLILEGCQ
IHYSQLSAILPALSRCSQLTTFYFGRNCMSIDALKDLLRHTSGLSKLSLETYPAPEESLN
SLVRVNWEIFTPLRAELMCTLREVRQPKRIFIGPTPCPSCGSSPSEELELHLCC
Download sequence
Identical sequences HR6148 9606.ENSP00000332134 ENSP00000332134 ENSP00000332134 gi|12738831|ref|NP_075389.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]