SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000332861 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000332861
Domain Number 1 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 499-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 443-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 331-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 10-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-21
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 7 Region: 545-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-19
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 8 Region: 234-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000019
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 9 Region: 196-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000289
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSP00000332861
Domain Number - Region: 142-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000391
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000332861   Gene: ENSG00000183647   Transcript: ENST00000332854
Sequence length 599
Comment pep:known chromosome:GRCh37:19:58111253:58119637:1 gene:ENSG00000183647 transcript:ENST00000332854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALRAPTQQVFVAFEDVAIYFSQEEWELLDEMQRLLYRDVMLENFAVMASLGCWCGAV
DEGTPSAESVSVEELSQGRTPKADTSTDKSHPCEICTPVLRDILQMIELHASPCGQKLYL
GGASRDFWMSSNLHQLQKLDNGEKLFKVDGDQASFMMNCRFHVSGKPFTFGEVGRDFSAT
SGLLQHQVTPTIERPHSRIRHLRVPTGRKPLKYTESRKSFREKSVFIQHQRADSGERPYK
CSECGKSFSQSSGFLRHRKAHGRTRTHECSECGKSFSRKTHLTQHQRVHTGERPYDCSEC
GKSFRQVSVLIQHQRVHTGERPYECSECGKSFSHSTNLYRHRSAHTSTRPYECSECGKSF
SHSTNLFRHWRVHTGVRPYECSECGKAFSCNIYLIHHQRFHTGERPYVCSECGKSFGQKS
VLIQHQRVHTGERPYECSECGKVFSQSSGLFRHRRAHTKTKPYECSECEKSFSCKTDLIR
HQTVHTGERPYECSVCGKSFIRKTHLIRHQTVHTNERPYECDECGKSYSQSSALLQHRRV
HTGERPYECRECGKSFTRKNHLIQHKTVHTGERPYECSECGKSFSQSSGLLRHRRVHVQ
Download sequence
Identical sequences Q6P9A1
ENSP00000332861 ENSP00000472564 ENSP00000332861 ENSP00000472564 NP_065931.3.87134 NP_065931.3.92137 9606.ENSP00000332861 ENSP00000332861 gi|167830431|ref|NP_065931.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]