SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000333725 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000333725
Domain Number 1 Region: 266-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 210-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-23
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 322-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-22
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 5 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 378-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.21e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 476-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 160-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000333725   Gene: ENSG00000198393   Transcript: ENST00000328654
Sequence length 533
Comment pep:known chromosome:GRCh37:12:133563050:133589154:1 gene:ENSG00000198393 transcript:ENST00000328654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSFRTASCWGLLSFKDISMEFTWDEWQLLDSTQKYLYRDVILENYHNLISVGYHGTKP
DLIFKLEQGEDPWIINAKISRQSCPDGWEEWYQNNQDELESIERSYACSVLGRLNLSKTH
DSSRQRLYNTRGKSLTQNSAPSRSYLRKNPDKFHGYEEPYFLKHQRAHSIEKNCVCSECG
KAFRCKSQLIVHLRIHTGERPYECSKCERAFSAKSNLNAHQRVHTGEKPYSCSECEKVFS
FRSQLIVHQEIHTGGKPYGCSECGKAYSWKSQLLLHQRSHTGVKPYECSECGKAFSLKSP
FVVHQRTHTGVKPHKCSECGKAFRSKSYLLVHIRMHTGEKPYQCSDCGKAFNMKTQLIVH
QGVHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIHRRTH
TGERPYECSLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEK
PFKCSECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK
Download sequence
Identical sequences P17031 V9HW07
ENSP00000333725 ENSP00000375416 ENSP00000333725 ENSP00000375416 NP_062537.2.87134 NP_062537.2.92137 9606.ENSP00000333725 9606.ENSP00000375416 gi|310124321|ref|XP_003119263.1| gi|310124323|ref|XP_003119264.1| gi|341913855|ref|XP_003403702.1| gi|341913857|ref|XP_003403703.1| gi|37655175|ref|NP_062537.2| ENSP00000333725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]