SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000333802 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000333802
Domain Number 1 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.7e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 238-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-22
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 431-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.48e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.12e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 7-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 7 Region: 529-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 198-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.52e-17
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 9 Region: 282-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000165
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000333802   Gene: ENSG00000153896   Transcript: ENST00000329285
Sequence length 588
Comment pep:known chromosome:GRCh37:19:35248979:35264120:-1 gene:ENSG00000153896 transcript:ENST00000329285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPALALVSFEDVVVTFTGEEWGHLDLAQRTLYQEVMLETCRLLVSLGHPVPKPELIYL
LEHGQELWTVKRGLSQSTCAGEKAKPKITEPTASQLAFSEESSFQELLAQRSSRDSRLGQ
ARDEEKLIKIQEGNLRPGTNPHKEICPEKLSYKHDDLEPDDSLGLRVLQERVTPQDALHE
CDSQGPGKDPMTDARNNPYTCTECGKGFSKKWALVRHQQIHAGVKPYECNECGKACRYMA
DVIRHMRLHTGEKPYKCIECGKAFKRRFHLTEHQRIHTGDKPYECKECGKAFTHRSSFIQ
HNMTHTREKPFLCKECGKAFYYSSSFAQHMRIHTGKKLYECGECGKAFTHRSTFIQHNVT
HTGEKPFLCKECGKTFCLNSSFTQHMRIHTGEKPYECGECGKAFTHRSTFIRHKRTHTGE
KPFECKECGKAFCDSSSLIQHMRIHTGEKPYECSECGKAFTHHSVFIRHNRTHSGQKPLE
CKECAKAFYYSSSFTRHMRIHTGEKPYVCRECGKAFTQPANFVRHNRIHTGEKPFECKEC
EKAFCDNFALTQHMRTHTGEKPFECNECGKTFSHSSSFTHHRKIHTRV
Download sequence
Identical sequences Q96NL3
9606.ENSP00000333802 gi|55925466|ref|NP_001007249.1| ENSP00000333802 NP_001007249.1.87134 NP_001007249.1.92137 ENSP00000333802 ENSP00000333802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]