SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000334641 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000334641
Domain Number 1 Region: 450-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 562-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-24
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 3 Region: 17-77
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-24
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 4 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 395-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 7 Region: 604-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.72e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 283-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000155
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 9 Region: 226-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000707
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000334641   Gene: ENSG00000197779   Transcript: ENST00000334937
Sequence length 661
Comment pep:known chromosome:GRCh37:X:47696345:47747609:1 gene:ENSG00000197779 transcript:ENST00000334937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPANEDAPQPGEHGSACEVSVSFEDVTVDFSREEWQQLDSTQRRLYQDVMLENYSHLLSV
GFEVPKPEVIFKLEQGEGPWTLEGEAPHQSCSDGKFGIKPSQRRISGKSTFHSEMEGEDT
RDDSLYSILEELWQDAEQIKRCQEKHNKLLSRTTFLNKKILNTEWDYEYKDFGKFVHPSP
NLILSQKRPHKRDSFGKSFKHNLDLHIHNKSNAAKNLDKTIGHGQVFTQNSSYSHHENTH
TGVKFCERNQCGKVLSLKHSLSQNVKFPIGEKANTCTEFGKIFTQRSHFFAPQKIHTVEK
PHELSKCVNVFTQKPLLSIYLRVHRDEKLYICTKCGKAFIQNSELIMHEKTHTREKPYKC
NECGKSFFQVSSLLRHQTTHTGEKLFECSECGKGFSLNSALNIHQKIHTGERHHKCSECG
KAFTQKSTLRMHQRIHTGERSYICTQCGQAFIQKAHLIAHQRIHTGEKPYECSDCGKSFP
SKSQLQMHKRIHTGEKPYICTECGKAFTNRSNLNTHQKSHTGEKSYICAECGKAFTDRSN
FNKHQTIHTGEKPYVCADCGRAFIQKSELITHQRIHTTEKPYKCPDCEKSFSKKPHLKVH
QRIHTGEKPYICAECGKAFTDRSNFNKHQTIHTGDKPYKCSDCGKGFTQKSVLSMHRNIH
T
Download sequence
Identical sequences A0A2I2Z1I9 P51508
NP_009068.2.87134 NP_009068.2.92137 XP_004064134.1.27298 XP_005272657.1.92137 XP_011542201.1.92137 XP_011542202.1.92137 XP_016884975.1.92137 XP_016884976.1.92137 XP_018875384.1.27298 ENSP00000341151 ENSP00000366153 ENSP00000469002 ENSP00000472283 gi|148727251|ref|NP_009068.2| ENSP00000341151 ENSP00000366153 9606.ENSP00000341151 ENSP00000334641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]