SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000334695 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000334695
Domain Number 1 Region: 459-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 319-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 35-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-20
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 500-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.94e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 263-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-16
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 7 Region: 152-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000102
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 365-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000356
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 193-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000124
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000334695   Gene: ENSG00000186020   Transcript: ENST00000334116
Sequence length 563
Comment pep:known chromosome:GRCh37:19:37034518:37064190:-1 gene:ENSG00000186020 transcript:ENST00000334116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSSFIGDHVHGAPHAVMPEVEFPDQFFTVLTMDHELVTLRDVVINFSQEEWEYLDSAQ
RNLYWDVMMENYSNLLSLDLESRNETKHLSVGKDIIQNTGSQWEVMESSKLCGLEGSIFR
NDWQSKSKIDLQGPEVGYFSQMKIISENVPSYKTHESLTLPRRTHDSEKPYEYKEYEKVF
SCDLEFDEYQKIHTGGKNYECNQCWKTFGIDNSSMLQLNIHTGVKPCKYMEYGNTCSFYK
DFNVYQKIHNEKFYKCKEYRRTFERVGKVTPLQRVHDGEKHFECSFCGKSFRVHAQLTRH
QKIHTDEKTYKCMECGKDFRFHSQLTEHQRIHTGEKPYKCMHCEKVFRISSQLIEHQRIH
TGEKPYACKECGKAFGVCRELARHQRIHTGKKPYECKACGKVFRNSSSLTRHQRIHTGEK
PYKCKECEKAFGVGSELTRHERIHSGQKPYECKECGKFFRLTSALIQHQRIHSGEKPYEC
KVCGKAFRHSSALTEHQRIHTGEKPYECKACGKAFRHSSSFTKHQRIHTDDKPYECKECG
NSFSVVGHLTCQPKIYTGEKSFD
Download sequence
Identical sequences Q6P280
ENSP00000465578 gi|224549028|ref|NP_066002.3| gi|224549030|ref|NP_001139121.1| NP_001139121.1.87134 NP_001139121.1.92137 NP_066002.3.87134 NP_066002.3.92137 XP_006723365.1.92137 XP_011525466.1.92137 ENSP00000465578 ENSP00000334695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]