SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000335437 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000335437
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-23
Family KRAB domain (Kruppel-associated box) 0.00053
Further Details:      
 
Domain Number 2 Region: 431-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 376-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 235-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.2e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 179-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-17
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 7 Region: 475-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.11e-17
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 8 Region: 338-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000313
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 142-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000209
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Weak hits

Sequence:  ENSP00000335437
Domain Number - Region: 80-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0162
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000335437   Gene: ENSG00000132010   Transcript: ENST00000334213
Sequence length 532
Comment pep:known chromosome:GRCh37:19:12242165:12251222:-1 gene:ENSG00000132010 transcript:ENST00000334213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMFQDSVAFEDVAVSFTQEEWALLDPSQKNLYRDVMQETFKNLTSVGKTWKVQNIEDEYK
NPRRNLSLMREKLCESKESHHCGESFNQIADDMLNRKTLPGITPCESSVCGEVGTGHSSL
NTHIRADTGHKSSEYQEYGENPYRNKECKKAFSYLDSFQSHDKACTKEKPYDGKECTETF
ISHSCIQRHRVMHSGDGPYKCKFCGKAFYFLNLCLIHERIHTGVKPYKCKQCGKAFTRST
TLPVHERTHTGVNADECKECGNAFSFPSEIRRHKRSHTGEKPYECKQCGKVFISFSSIQY
HKMTHTGEKPYECKQCGKAFRCGSHLQKHGRTHTGEKPYECRQCGKAFRCTSDLQRHEKT
HTEDKPYGCKQCGKGFRCASQLQIHERTHSGEKPHECKECGKVFKYFSSLRIHERTHTGE
KPHECKQCGKAFRYFSSLHIHERTHTGDKPYECKVCGKAFTCSSSIRYHERTHTGEKPYE
CKHCGKAFISNYIRYHERTHTGEKPYQCKQCGKAFIRASSCREHERTHTINR
Download sequence
Identical sequences P17024
9606.ENSP00000335437 ENSP00000335437 NP_066966.2.87134 NP_066966.2.92137 ENSP00000335437 ENSP00000335437 gi|116875829|ref|NP_066966.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]