SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000337122 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000337122
Domain Number 1 Region: 362-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.09e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.71e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 502-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 449-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.63e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 250-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 544-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-20
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 7 Region: 212-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-16
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 8 Region: 306-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000705
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 9 Region: 409-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000111
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSP00000337122
Domain Number - Region: 168-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00173
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000337122   Gene: ENSG00000169131   Transcript: ENST00000335815
Sequence length 605
Comment pep:known chromosome:GRCh37:5:178138593:178157703:-1 gene:ENSG00000169131 transcript:ENST00000335815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGQREARPQVSLTFEDVAVLFTRDEWRKLAPSQRNLYRDVMLENYRNLVSLGLPFTKP
KVISLLQQGEDPWEVEKDGSGVSSLGSKSSHKTTKSTQTQDSSFQGLILKRSNRNVPWDL
KLEKPYIYEGRLEKKQDKKGSFQIVSATHKKIPTIERSHKNTELSQNFSPKSVLIRQQIL
PREKTPPKCEIQGNSLKQNSQLLNQPKITADKRYKCSLCEKTFINTSSLRKHEKNHSGEK
LFKCKECSKAFSQSSALIQHQITHTGEKPYICKECGKAFTLSTSLYKHLRTHTVEKSYRC
KECGKSFSRRSGLFIHQKIHAEENPCKYNPGRKASSCSTSLSGCQRIHSRKKSYLCNECG
NTFKSSSSLRYHQRIHTGEKPFKCSECGRAFSQSASLIQHERIHTGEKPYRCNECGKGFT
SISRLNRHRIIHTGEKFYNCNECGKALSSHSTLIIHERIHTGEKPCKCKVCGKAFRQSSA
LIQHQRMHTGERPYKCNECGKTFRCNSSLSNHQRIHTGEKPYRCEECGISFGQSSALIQH
RRIHTGEKPFKCNTCGKTFRQSSSRIAHQRIHTGEKPYECNTCGKLFNHRSSLTNHYKIH
IEEDP
Download sequence
Identical sequences O60765 V9HWI2
ENSP00000337122 ENSP00000337122 9606.ENSP00000337122 ENSP00000337122 NP_005640.2.87134 NP_005640.2.92137 XP_016865280.1.92137 gi|37537689|ref|NP_005640.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]