SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000340514 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000340514
Domain Number 1 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.74e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.62e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.21e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 6 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-20
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 7 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-19
Family KRAB domain (Kruppel-associated box) 0.00041
Further Details:      
 
Domain Number 8 Region: 585-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 9 Region: 193-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 10 Region: 163-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-16
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 11 Region: 88-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000629
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 12 Region: 138-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000338
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000340514   Gene: ENSG00000105708   Transcript: ENST00000344099
Sequence length 642
Comment pep:known chromosome:GRCh37:19:19821280:19843906:-1 gene:ENSG00000105708 transcript:ENST00000344099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVSFEDVAVNFTLEEWALLDSSQKKLYEDVMQETFKNLVCLGKKWEDQDIEDDHRNQG
KNRRCHMVERLCESRRGSKCGETTSQMPNVNINKETFTGAKPHECSFCGRDFIHHSSLNR
HMRSHTGQKPNEYQEYEKQPCKCKAVGKTFSYHHCFRKHERTHTGVKPYECKQCGKAFIY
YQPFQRHERTHAGQKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQCGKAFICYQSFQR
HKRTHTGEKPYECKQCGKAFSCPTYFRTHERTHTGEKPYKCKECGKAFSFLSSFRRHKRT
HSGEKPYECKECGKAFFYSASFRAHVIIHTGARPYKCKECGKAFNSSNSCRVHERTHIGE
KPYECKRCGKSFSWSISLRLHERTHTGEKPYECKQCHKTFSFSSSLREHETTHTGEKPYE
CKQCGKTFSFSSSLQRHERTHNAEKPYECKQCGKAFRCSSYFRIHERSHTGEKPYECKQC
GKVFIRSSSFRLHERTHTGEKPYECKLCGKTFSFSSSLREHEKIHTGNKPFECKQCGKAF
LRSSQIRLHERTHTGEKPYQCKQCGKAFISSSKFRMHERTHTGEKPYRCKQCGKAFRFSS
SVRIHERSHTGEKPYECKQCGKAFISSSHFRLHERTHMGEKV
Download sequence
Identical sequences P17017
ENSP00000340514 NP_066358.2.87134 NP_066358.2.92137 gi|38045952|ref|NP_066358.2| ENSP00000340514 ENSP00000340514 9606.ENSP00000340514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]