SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000340711 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000340711
Domain Number 1 Region: 439-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 11-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 382-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 271-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.79e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 5 Region: 327-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 536-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.62e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 232-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-17
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 8 Region: 494-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000142
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000340711   Gene: ENSG00000175787   Transcript: ENST00000340911
Sequence length 603
Comment pep:known chromosome:GRCh37:9:97041039:97063736:1 gene:ENSG00000175787 transcript:ENST00000340911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPGLLTTRKEALMAFRDVAVAFTQKEWKLLSSAQRTLYREVMLENYSHLVSLGIAFSKP
KLIEQLEQGDEPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIF
PSSSAGGDFQLEAPRCSSEKGESGETEGPDSSLRKRPSRISRTFFSPHQGDPVEWVEGNR
EGGTDLRLAQRMSLGGSDTMLKGADTSESGAVIRGNYRLGLSKKSSLFSHQKHHVCPECG
RGFCQRSDLIKHQRTHTGEKPYLCPECGRRFSQKASLSIHQRKHSGEKPYVCRECGRHFR
YTSSLTNHKRIHSGERPFVCQECGRGFRQKIALLLHQRTHLEEKPFVCPECGRGFCQKAS
LLQHQSSHTGERPFLCLECGRSFRQQSLLLSHQVTHSGEKPYVCAECGHSFRQKVTLIRH
QRTHTGEKPYLCPQCGRGFSQKVTLIGHQRTHTGEKPYLCPDCGRGFGQKVTLIRHQRTH
TGEKPYLCPKCGRAFGFKSLLTRHQRTHSEEELYVDRVCGQGLGQKSHLISDQRTHSGEK
PCICDECGRGFGFKSALIRHQRTHSGEKPYVCRECGRGFSQKSHLHRHRRTKSGHQLLPQ
EVF
Download sequence
Identical sequences Q14929
NP_919301.2.87134 NP_919301.2.92137 gi|110815807|ref|NP_919301.2| ENSP00000340711 9606.ENSP00000378792 ENSP00000378792 ENSP00000378792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]