SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000341528 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000341528
Domain Number 1 Region: 400-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 344-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.29e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.61e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 30-92
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-21
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 501-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 232-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-18
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 191-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000453
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000341528   Gene: ENSG00000196378   Transcript: ENST00000343459
Sequence length 560
Comment pep:known chromosome:GRCh37:8:145998499:146012689:-1 gene:ENSG00000196378 transcript:ENST00000343459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLSDQLLLTALRKPNPQAMAALFLSAPPQAEVTFEDVAVYLSREEWGRLGPAQRGLY
RDVMLETYGNLVSLGVGPAGPKPGVISQLERGDEPWVLDVQGTSGKEHLRVNSPALGTRT
EYKELTSQETFGEEDPQGSEPVEACDHISKSEGSLEKLVEQRGPRAVTLTNGESSRESGG
NLRLLSRPVPDQRPHKCDICEQSFEQRSYLNNHKRVHRSKKTNTVRNSGEIFSANLVVKE
DQKIPTGKKLHYCSYCGKTFRYSANLVKHQRLHTEEKPYKCDECGKAFSQSCEFINHRRM
HSGEIPYRCDECGKTFTRRPNLMKHQRIHTGEKPYKCGECGKHFSAYSSLIYHQRIHTGE
KPYKCNDCGKAFSDGSILIRHRRTHTGEKPFECKECGKGFTQSSNLIQHQRIHTGEKPYK
CNECEKAFIQKTKLVEHQRSHTGEKPYECNDCGKVFSQSTHLIQHQRIHTGEKPYKCSEC
GKAFHNSSRLIHHQRLHHGEKPYRCSDCKKAFSQSTYLIQHRRIHTGEKPYKCSECGKAF
RHSSNMCQHQRIHLREDFSM
Download sequence
Identical sequences Q8IZ26
NP_085057.3.87134 NP_085057.3.92137 XP_011515616.1.92137 XP_016869361.1.92137 XP_016869362.1.92137 XP_016869363.1.92137 ENSP00000341528 ENSP00000341528 ENSP00000341528 gi|157954634|ref|NP_085057.3| 9606.ENSP00000341528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]