SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000342100 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000342100
Domain Number - Region: 496-621
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.068
Family IMD domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000342100   Gene: ENSG00000070367   Transcript: ENST00000340918
Sequence length 708
Comment pep:novel chromosome:GRCh37:14:57674878:57735617:-1 gene:ENSG00000070367 transcript:ENST00000340918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTAELFEEPFVADEYIERLVWRTPGGGSRGGPEAFDPKRLLEEFVNHIQELQIMDERI
QRKVEKLEQQCQKEAKEFAKKVQELQKSNQVAFQHFQELDEHISYVATKVCHLGDQLEGV
NTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKIKEAADIIQKLHLIAQELPFDRFSE
VKSKIASKYHDLECQLIQEFTSAQRRGEISRMREVAAVLLHFKGYSHCVDVYIKQCQEGA
YLRNDIFEDAGILCQRVNKQVGDIFSNPETVLAKLIQNVFEIKLQSFVKEQLEECRKSDA
EQYLKNLYDLYTRTTNLSSKLMEFNLGTDKQTFLSKLIKSIFISYLENYIEVETGYLKSR
SAMILQRYYDSKNHQKRSIGTGGIQDLKERIRQRTNLPLGPSIDTHGETFLSQEVVVNLL
QETKQAFERCHRLSDPSDLPRNAFRIFTILVEFLCIEHIDYALETGLAGIPSSDSRNANL
YFLDVVQQANTIFHLFDKQFNDHLMPLISSSPKLSECLQKKKEIIEQMEMKLDTGIDRTL
NCMIGQMKHILAAEQKKTDFKPEDENNVLIQYTNACVKVCAYVRKQVEKIKNSMDGKNVD
TVLMELGVRFHRLIYEHLQQYSYSCMGGMLAICDVAEYRKCAKDFKIPMVLHLFDTLHAL
CNLLVVAPDNLKQVCSGEQLANLDKNILHSFVQLRADYRSARLARHFS
Download sequence
Identical sequences H2R434 O00471
9606.ENSP00000389934 ENSP00000389934 gi|5730037|ref|NP_006535.1| ENSPTRP00000046511 ENSPTRP00000046511 NP_006535.1.87134 NP_006535.1.92137 XP_003831717.1.60992 XP_509969.2.37143 ENSP00000342100 NYSGRC-5730037 ENSP00000484855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]