SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000343625 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000343625
Domain Number 1 Region: 220-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.16e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 333-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 473-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 4-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 514-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.48e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 182-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000196
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 379-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000361
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000343625   Gene: ENSG00000221923   Transcript: ENST00000344085
Sequence length 577
Comment pep:known chromosome:GRCh37:19:52873192:52877970:1 gene:ENSG00000221923 transcript:ENST00000344085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRGHLAFRDVAIEFPQEEWKCLDPAQRTLYREVMVENYRNLVFLGICLPDLSVISMLE
QRRDPRNLQSEVKIANNPGGRECIKGVNAESSSKLGSNAGNKSLKNQLGLTFQLHLSELQ
LFQAERNISGCKHVEKPINNSLVSPLQKIYSSVKSHILNKYRNDFDDSPFLPQEQKAQIR
EKPCECNEHGKAFRVSSRLANNQVIHTADNPYKCNECDKVFSNSSNLVQHQRIHTGEKPY
KCHECGKLFNRISLLARHQRIHTGEKPYKCHECGKVFTQNSHLANHHRIHTGEKPYKCNE
CGKVFNRNAHLARHQKIHSGEKPYKCKECGKAFSGGSGLTAHLVIHTGEKLYKCNKCGKV
FNRNAHLTRHQRIHTGEKPYECKECGKVFRHKFCLTNHHRMHTGEQPYKCNECGKAFRDC
SGLTAHLLIHTGEKPYKCKECAKVFRHRLSLSNHQRFHTGEKPYRCDECGKDFTRNSNLA
NHHRIHTGEKPYKCSECHKVFSHNSHLARHRQIHTGEKSYKCNECGKVFSHKLYLKKHER
IHTGEKPYRCHECGKDFTRNSNLANHHRIHTGEKPYR
Download sequence
Identical sequences Q6PDB4
ENSP00000343625 ENSP00000406318 NP_001138906.1.87134 NP_001138906.1.92137 XP_016882301.1.92137 9606.ENSP00000406318 gi|224177533|ref|NP_001138906.1| ENSP00000406318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]