SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000344136 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000344136
Domain Number 1 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.25e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.37e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 459-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 235-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 17-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-21
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 7 Region: 501-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-21
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 8 Region: 182-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000344136   Gene: ENSG00000196150   Transcript: ENST00000342660
Sequence length 560
Comment pep:known chromosome:GRCh37:8:146092748:146126850:-1 gene:ENSG00000196150 transcript:ENST00000342660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARLLPVPAGPQPLSFQAKLTFEDVAVLLSQDEWDRLCPAQRGLYRNVMMETYGNVVS
LGLPGSKPDIISQLERGEDPWVLDRKGAKKSQGLWSDYSDNLKYDHTTACTQQDSLSCPW
ECETKGESQNTDLSPKPLISEQTVILGKTPLGRIDQENNETKQSFCLSPNSVDHREVQVL
SQSMPLTPHQAVPSGERPYMCVECGKCFGRSSHLLQHQRIHTGEKPYVCSVCGKAFSQSS
VLSKHRRIHTGEKPYECNECGKAFRVSSDLAQHHKIHTGEKPHECLECRKAFTQLSHLIQ
HQRIHTGERPYVCPLCGKAFNHSTVLRSHQRVHTGEKPHRCNECGKTFSVKRTLLQHQRI
HTGEKPYTCSECGKAFSDRSVLIQHHNVHTGEKPYECSECGKTFSHRSTLMNHERIHTEE
KPYACYECGKAFVQHSHLIQHQRVHTGEKPYVCGECGHAFSARRSLIQHERIHTGEKPFQ
CTECGKAFSLKATLIVHLRTHTGEKPYECNSCGKAFSQYSVLIQHQRIHTGEKPYECGEC
GRAFNQHGHLIQHQKVHRKL
Download sequence
Identical sequences P15622
ENSP00000292579 gi|45387947|ref|NP_066405.1| ENSP00000344136 NP_066405.1.87134 NP_066405.1.92137 XP_006716675.1.92137 XP_006716676.1.92137 ENSP00000292579 9606.ENSP00000292579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]