SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000344206 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000344206
Domain Number 1 Region: 193-396
Classification Level Classification E-value
Superfamily Rhomboid-like 2.35e-32
Family Rhomboid-like 0.0051
Further Details:      
 
Domain Number 2 Region: 77-134
Classification Level Classification E-value
Superfamily EF-hand 0.00000857
Family Calmodulin-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000344206   Gene: ENSG00000103269   Transcript: ENST00000352681
Sequence length 438
Comment pep:known chromosome:GRCh37:16:725666:728268:1 gene:ENSG00000103269 transcript:ENST00000352681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRVEDGGTTEELEDWDPGTSALPAPGIKQGPREQTGTGPLSQKCWEPEPDAPSQPGPAL
WSRGRARTQALAGGSSLQQLDPENTGFIGADTFTGLVHSHELPLDPAKLDMLVALAQSNE
QGQVCYQELVDLISSKRSSSFKRAIANGQRALPRDGPLDEPGLGVYKRFVRYVAYEILPC
EVDRRWYFYRHRSCPPPVFMASVTLAQIIVFLCYGARLNKWVLQTYHPEYMKSPLVYHPG
HRARAWRFLTYMFMHVGLEQLGFNALLQLMIGVPLEMVHGLLRISLLYLAGVLAGSLTVS
ITDMRAPVVGGSGGVYALCSAHLANVVMNWAGMRCPYKLLRMVLALVCMSSEVGRAVWLR
FSPPLPASGPQPSFMAHLAGAVVGVSMGLTILRSYEERLRDQCGWWVVLLAYGTFLLFAV
FWNVFAYDLLGAHIPPPP
Download sequence
Identical sequences O75783
ENSP00000344206 9606.ENSP00000219551 ENSP00000219551 gi|4506525|ref|NP_003952.1| NP_001305662.1.87134 NP_001305662.1.92137 ENSP00000219551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]