SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000347041 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000347041
Domain Number 1 Region: 80-358
Classification Level Classification E-value
Superfamily L domain-like 1.62e-50
Family Ngr ectodomain-like 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000347041   Gene: ENSG00000122176   Transcript: ENST00000354955
Sequence length 376
Comment pep:known chromosome:GRCh37:1:203309756:203320617:-1 gene:ENSG00000122176 transcript:ENST00000354955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEG
PAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSI
QEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRE
LHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPD
GLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDL
SYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAM
PADAPLCLRLASLIEI
Download sequence
Identical sequences A0A024R971 G3R879 K7A2A5 Q06828
ENSGGOP00000011582 9598.ENSPTRP00000003137 9606.ENSP00000347041 NP_002014.2.87134 NP_002014.2.92137 XP_018884545.1.27298 XP_514114.1.37143 ENSP00000347041 ENSP00000347041 gi|71040111|ref|NP_002014.2| ENSP00000347041 ENSGGOP00000011582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]